SCOPe 2.07: Domain d1o3tb1: 1o3t B:138-205

Lineage for d1o3tb1 (1o3t B:138-205)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)

8. Domain d1o3tb1: 1o3t B:138-205 [86613]
   Other proteins in same PDB: d1o3ta2, d1o3tb2
   protein/DNA complex; complexed with cmp

Details for d1o3tb1

PDB Entry: 1o3t, 2.8 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

PDB Compounds: (B:) catabolite gene activator protein

SCOPe Domain Sequences for d1o3tb1:

Sequence; same for both SEQRES and ATOM records:

>d1o3tb1 a.4.5.4 (B:138-205) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivv

Timeline for d1o3tb1:

• d1o3tb1 first appeared in SCOP 1.65
  
• d1o3tb1 appears in SCOPe 2.06
  
• d1o3tb1 appears in the current release, SCOPe 2.08