SCOP 1.75: Domain d1o2fb_: 1o2f B:

Lineage for d1o2fb_ (1o2f B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family)

5. Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)

6. Protein Glucose permease domain IIB [55606] (1 species)

7. Species Escherichia coli [TaxId:562] [55607] (3 PDB entries)
   there are differences in secondary structure packing between the two NMR-determined structures

8. Domain d1o2fb_: 1o2f B: [86594]
   Other proteins in same PDB: d1o2fa_
   complexed with po3

Details for d1o2fb_

PDB Entry: 1o2f

PDB Description: complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

PDB Compounds: (B:) PTS system, glucose-specific IIBC component

SCOP Domain Sequences for d1o2fb_:

Sequence; same for both SEQRES and ATOM records:

>d1o2fb_ d.95.1.1 (B:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
emaaalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaif
gtksdnlktemdeyirn

Timeline for d1o2fb_:

• d1o2fb_ first appeared in SCOP 1.65
  
• d1o2fb_ appears in SCOP 1.73
  
• d1o2fb_ appears in SCOPe 2.01
  
• d1o2fb_ appears in the current release, SCOPe 2.08