Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets |
Family b.84.3.1: Glucose permease-like [51262] (3 proteins) |
Protein Glucose-specific factor III (glsIII) [51266] (1 species) synonym: enzyme IIa-glc |
Species Escherichia coli [TaxId:562] [51267] (11 PDB entries) |
Domain d1o2fa_: 1o2f A: [86593] Other proteins in same PDB: d1o2fb_ |
PDB Entry: 1o2f (more details)
SCOPe Domain Sequences for d1o2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o2fa_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv visnmdeikeliklsgsvtvgetpvirikk
Timeline for d1o2fa_: