Lineage for d1o2fa_ (1o2f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809208Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 1809209Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 1809216Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 1809217Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)
  8. 1809229Domain d1o2fa_: 1o2f A: [86593]
    Other proteins in same PDB: d1o2fb_

Details for d1o2fa_

PDB Entry: 1o2f (more details)

PDB Description: complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (A:) pts system, glucose-specific iia component

SCOPe Domain Sequences for d1o2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o2fa_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

SCOPe Domain Coordinates for d1o2fa_:

Click to download the PDB-style file with coordinates for d1o2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1o2fa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o2fb_