| Class b: All beta proteins [48724] (174 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) ![]() half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets |
| Family b.84.3.1: Glucose permease-like [51262] (2 proteins) |
| Protein Glucose-specific factor III (glsIII) [51266] (1 species) synonym: enzyme IIa-glc |
| Species Escherichia coli [TaxId:562] [51267] (10 PDB entries) |
| Domain d1o2fa_: 1o2f A: [86593] Other proteins in same PDB: d1o2fb_ complexed with po3 |
PDB Entry: 1o2f (more details)
SCOP Domain Sequences for d1o2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o2fa_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk
Timeline for d1o2fa_: