Lineage for d1o2db1 (1o2d B:2-358)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249347Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2249348Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2249378Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 2249379Protein Alcohol dehydrogenase TM0920 [75612] (1 species)
  7. 2249380Species Thermotoga maritima [TaxId:2336] [75613] (3 PDB entries)
  8. 2249382Domain d1o2db1: 1o2d B:2-358 [86592]
    Other proteins in same PDB: d1o2da2, d1o2db2
    structural genomics; high-resolution structure
    complexed with fe, nap, trs

Details for d1o2db1

PDB Entry: 1o2d (more details), 1.3 Å

PDB Description: crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution
PDB Compounds: (B:) Alcohol dehydrogenase, iron-containing

SCOPe Domain Sequences for d1o2db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o2db1 e.22.1.2 (B:2-358) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]}
wefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisye
ifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedlyd
rekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsde
ltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfvasc
lagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhifg
gsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealg

SCOPe Domain Coordinates for d1o2db1:

Click to download the PDB-style file with coordinates for d1o2db1.
(The format of our PDB-style files is described here.)

Timeline for d1o2db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o2db2