Lineage for d1o2da_ (1o2d A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339768Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 339769Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) (S)
  5. 339794Family e.22.1.2: Glycerol dehydrogenase-like [69892] (2 proteins)
  6. 339795Protein Alcohol dehydrogenase TM0920 [75612] (1 species)
  7. 339796Species Thermotoga maritima [TaxId:243274] [75613] (1 PDB entry)
  8. 339797Domain d1o2da_: 1o2d A: [86591]

Details for d1o2da_

PDB Entry: 1o2d (more details), 1.3 Å

PDB Description: crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution

SCOP Domain Sequences for d1o2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima}
vwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisy
eifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedly
drekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsd
eltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfvas
clagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhif
ggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv

SCOP Domain Coordinates for d1o2da_:

Click to download the PDB-style file with coordinates for d1o2da_.
(The format of our PDB-style files is described here.)

Timeline for d1o2da_: