Lineage for d1o29a_ (1o29 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944317Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1944318Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
    automatically mapped to Pfam PF02511
  5. 1944319Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1944320Protein Thy1 homologue [69798] (1 species)
  7. 1944321Species Thermotoga maritima [TaxId:2336] [69799] (22 PDB entries)
    TM0449
  8. 1944342Domain d1o29a_: 1o29 A: [86578]
    structural genomics
    complexed with fad, ufp

Details for d1o29a_

PDB Entry: 1o29 (more details), 2 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution
PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o29a_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
ivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervt
ekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsha
qweiqqyalaiarifkekcpwtfeaflkyaykgdil

SCOPe Domain Coordinates for d1o29a_:

Click to download the PDB-style file with coordinates for d1o29a_.
(The format of our PDB-style files is described here.)

Timeline for d1o29a_: