Lineage for d1o28b_ (1o28 B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880175Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 880176Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
  5. 880177Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (1 protein)
  6. 880178Protein Thy1 homologue [69798] (1 species)
  7. 880179Species Thermotoga maritima [TaxId:2336] [69799] (9 PDB entries)
    TM0449
  8. 880197Domain d1o28b_: 1o28 B: [86575]
    structural genomics

Details for d1o28b_

PDB Entry: 1o28 (more details), 2.1 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fdump at 2.1 a resolution
PDB Compounds: (B:) Thymidylate synthase thyX

SCOP Domain Sequences for d1o28b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o28b_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

SCOP Domain Coordinates for d1o28b_:

Click to download the PDB-style file with coordinates for d1o28b_.
(The format of our PDB-style files is described here.)

Timeline for d1o28b_: