Lineage for d1o26c_ (1o26 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515856Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 515857Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
  5. 515858Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (1 protein)
  6. 515859Protein Thy1 homologue [69798] (1 species)
  7. 515860Species Thermotoga maritima [TaxId:243274] [69799] (9 PDB entries)
    TM0449
  8. 515863Domain d1o26c_: 1o26 C: [86568]

Details for d1o26c_

PDB Entry: 1o26 (more details), 1.6 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution

SCOP Domain Sequences for d1o26c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o26c_ d.207.1.1 (C:) Thy1 homologue {Thermotoga maritima}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkev

SCOP Domain Coordinates for d1o26c_:

Click to download the PDB-style file with coordinates for d1o26c_.
(The format of our PDB-style files is described here.)

Timeline for d1o26c_: