Lineage for d1o26a_ (1o26 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445792Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1445793Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
    automatically mapped to Pfam PF02511
  5. 1445794Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1445795Protein Thy1 homologue [69798] (1 species)
  7. 1445796Species Thermotoga maritima [TaxId:2336] [69799] (19 PDB entries)
    TM0449
  8. 1445799Domain d1o26a_: 1o26 A: [86566]
    structural genomics
    complexed with fad, pge, ump

Details for d1o26a_

PDB Entry: 1o26 (more details), 1.6 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o26a_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfe
hivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttipperv
tekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsh
aqweiqqyalaiarifkekcpwtfeaflkyaykgdilke

SCOPe Domain Coordinates for d1o26a_:

Click to download the PDB-style file with coordinates for d1o26a_.
(The format of our PDB-style files is described here.)

Timeline for d1o26a_: