Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (2 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (4 proteins) |
Protein Gamma-glutamyl phosphate reductase [89781] (2 species) |
Species Thermotoga maritima [TaxId:243274] [89782] (1 PDB entry) TM0293 |
Domain d1o20a_: 1o20 A: [86556] structural genomics |
PDB Entry: 1o20 (more details), 2 Å
SCOP Domain Sequences for d1o20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima} dellekakkvreawdvlrnattreknkaikkiaeklderrkeileanridvekarergvk eslvdrlalndkridemikacetviglkdpvgevidswvredglriarvrvpigpigiiy esrpnvtvettilalksgntillrggsdalnsnkaivsairealketeipessvefient drslvlemirlreylslviprggyglisfvrdnatvpvletgvgnchifvdesadlkkav pviinaktqrpgtcnaaekllvhekiakeflpviveelrkhgvevrgcektreivpdvvp ateddwpteyldliiaikvvknvdeaiehikkystghsesiltenysnakkfvseidaaa vyvnastrftdggqfgfgaeigistqrfhargpvglrelttykfvvlgeyhvre
Timeline for d1o20a_: