Lineage for d1o20a_ (1o20 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140961Protein Gamma-glutamyl phosphate reductase [89781] (2 species)
  7. 2140965Species Thermotoga maritima [TaxId:2336] [89782] (1 PDB entry)
    TM0293
  8. 2140966Domain d1o20a_: 1o20 A: [86556]
    structural genomics

Details for d1o20a_

PDB Entry: 1o20 (more details), 2 Å

PDB Description: crystal structure of gamma-glutamyl phosphate reductase (tm0293) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (A:) Gamma-glutamyl phosphate reductase

SCOPe Domain Sequences for d1o20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]}
dellekakkvreawdvlrnattreknkaikkiaeklderrkeileanridvekarergvk
eslvdrlalndkridemikacetviglkdpvgevidswvredglriarvrvpigpigiiy
esrpnvtvettilalksgntillrggsdalnsnkaivsairealketeipessvefient
drslvlemirlreylslviprggyglisfvrdnatvpvletgvgnchifvdesadlkkav
pviinaktqrpgtcnaaekllvhekiakeflpviveelrkhgvevrgcektreivpdvvp
ateddwpteyldliiaikvvknvdeaiehikkystghsesiltenysnakkfvseidaaa
vyvnastrftdggqfgfgaeigistqrfhargpvglrelttykfvvlgeyhvre

SCOPe Domain Coordinates for d1o20a_:

Click to download the PDB-style file with coordinates for d1o20a_.
(The format of our PDB-style files is described here.)

Timeline for d1o20a_: