SCOPe 2.07: Domain d1o1za1: 1o1z A:2-222

Lineage for d1o1za1 (1o1z A:2-222)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
   Pfam PF03009

6. Protein Hypothetical protein TM1621 [89509] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89510] (1 PDB entry)

8. Domain d1o1za1: 1o1z A:2-222 [86555]
   Other proteins in same PDB: d1o1za2
   structural genomics
   complexed with na

Details for d1o1za1

PDB Entry: 1o1z, 1.6 Å

PDB Description: crystal structure of glycerophosphodiester phosphodiesterase (gdpd) (tm1621) from thermotoga maritima at 1.60 a resolution

PDB Compounds: (A:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d1o1za1:

Sequence; same for both SEQRES and ATOM records:

>d1o1za1 c.1.18.3 (A:2-222) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]}
ivlghrgysakylentleafmkaieagangveldvrlskdgkvvvshdedlkrlfgldvk
irdatvselkeltdgkittlkevfenvsddkiinieikereaadavleiskkrknlifss
fdldlldekfkgtkygylideenygsienfvervekerpyslhvpyqafeleyavevlrs
frkkgivifvwtlndpeiyrkirreidgvitdevelfvklr

Timeline for d1o1za1:

• d1o1za1 first appeared in SCOP 1.65, called d1o1za_
  
• d1o1za1 appears in SCOPe 2.06
  
• d1o1za1 appears in the current release, SCOPe 2.08