| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
| Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins) Pfam PF03009 |
| Protein Hypothetical protein TM1621 [89509] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [89510] (1 PDB entry) |
| Domain d1o1za_: 1o1z A: [86555] structural genomics complexed with na |
PDB Entry: 1o1z (more details), 1.6 Å
SCOPe Domain Sequences for d1o1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1za_ c.1.18.3 (A:) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]}
hhhhvivlghrgysakylentleafmkaieagangveldvrlskdgkvvvshdedlkrlf
gldvkirdatvselkeltdgkittlkevfenvsddkiinieikereaadavleiskkrkn
lifssfdldlldekfkgtkygylideenygsienfvervekerpyslhvpyqafeleyav
evlrsfrkkgivifvwtlndpeiyrkirreidgvitdevelfvklr
Timeline for d1o1za_: