SCOPe 2.08: Domain d1o1xa1: 1o1x A:2-143

Lineage for d1o1xa1 (1o1x A:2-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
   automatically mapped to Pfam PF02502

6. Protein Putative sugar-phosphate isomerase [89627] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89628] (1 PDB entry)
   TM1080

8. Domain d1o1xa1: 1o1x A:2-143 [86553]
   Other proteins in same PDB: d1o1xa2
   structural genomics
   complexed with mpd

Details for d1o1xa1

PDB Entry: 1o1x, 1.9 Å

PDB Description: crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (A:) ribose-5-phosphate isomerase RpiB

SCOPe Domain Sequences for d1o1xa1:

Sequence; same for both SEQRES and ATOM records:

>d1o1xa1 c.121.1.1 (A:2-143) Putative sugar-phosphate isomerase {Thermotoga maritima [TaxId: 2336]}
kiaiasdhaafelkekvknyllgkgievedhgtyseesvdypdyakkvvqsilsneadfg
illcgtglgmsiaanryrgiraalclfpdmarlarshnnanilvlpgrligaelafwivd
tflstpfdggrherrirkidev

Timeline for d1o1xa1:

• d1o1xa1 first appeared in SCOP 1.65, called d1o1xa_
  
• d1o1xa1 appears in SCOPe 2.07