Lineage for d1o1ta_ (1o1t A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745817Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 1745818Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 1745819Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 1745834Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 1745848Domain d1o1ta_: 1o1t A: [86551]
    Other proteins in same PDB: d1o1tb_
    complexed with 2nh, mg, zn

Details for d1o1ta_

PDB Entry: 1o1t (more details), 2.1 Å

PDB Description: structure of fpt bound to the cvim-fpp product
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1o1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ta_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqskhs

SCOPe Domain Coordinates for d1o1ta_:

Click to download the PDB-style file with coordinates for d1o1ta_.
(The format of our PDB-style files is described here.)

Timeline for d1o1ta_: