Lineage for d1o1ta_ (1o1t A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 285094Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 285095Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 285096Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 285102Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (17 PDB entries)
  8. 285108Domain d1o1ta_: 1o1t A: [86551]
    Other proteins in same PDB: d1o1tb_
    complexed with 2nh, mg, zn

Details for d1o1ta_

PDB Entry: 1o1t (more details), 2.1 Å

PDB Description: structure of fpt bound to the cvim-fpp product

SCOP Domain Sequences for d1o1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ta_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqskhs

SCOP Domain Coordinates for d1o1ta_:

Click to download the PDB-style file with coordinates for d1o1ta_.
(The format of our PDB-style files is described here.)

Timeline for d1o1ta_: