Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries) Uniprot Q02293 22-418 P53610 |
Domain d1o1rb_: 1o1r B: [86548] Other proteins in same PDB: d1o1ra_ complexed with grg, zn |
PDB Entry: 1o1r (more details), 2.3 Å
SCOPe Domain Sequences for d1o1rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1rb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]} lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
Timeline for d1o1rb_: