Lineage for d1o1rb_ (1o1r B:)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array
Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (17 PDB entries) 
Domain d1o1rb_: 1o1r B: [86548]
Other proteins in same PDB: d1o1ra_
complexed with grg, zn
Details for d1o1rb_
PDB Entry: 1o1r (more details), 2.3 Å
PDB Description: structure of fpt bound to ggpp
SCOP Domain Sequences for d1o1rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1rb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
SCOP Domain Coordinates for d1o1rb_:
Click to download the PDB-style file with coordinates for d1o1rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o1rb_:
- d1o1rb_ is new in SCOP 1.65
- d1o1rb_ appears in SCOP 1.67
- d1o1rb_ appears in the current release, SCOPe 2.08
View in 3D
