Lineage for d1o1rb_ (1o1r B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284397Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) (S)
  5. 284444Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 284445Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 284451Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (17 PDB entries)
  8. 284458Domain d1o1rb_: 1o1r B: [86548]
    Other proteins in same PDB: d1o1ra_
    complexed with grg, zn

Details for d1o1rb_

PDB Entry: 1o1r (more details), 2.3 Å

PDB Description: structure of fpt bound to ggpp

SCOP Domain Sequences for d1o1rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1rb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOP Domain Coordinates for d1o1rb_:

Click to download the PDB-style file with coordinates for d1o1rb_.
(The format of our PDB-style files is described here.)

Timeline for d1o1rb_: