Lineage for d1o1ra_ (1o1r A:)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) 
Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins) Protein Protein farnesyltransferase alpha-subunit [48441] (2 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (17 PDB entries) 
Domain d1o1ra_: 1o1r A: [86547]
Other proteins in same PDB: d1o1rb_
complexed with grg, zn
Details for d1o1ra_
PDB Entry: 1o1r (more details), 2.3 Å
PDB Description: structure of fpt bound to ggpp
SCOP Domain Sequences for d1o1ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1ra_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqskhs
SCOP Domain Coordinates for d1o1ra_:
Click to download the PDB-style file with coordinates for d1o1ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o1ra_:
- d1o1ra_ is new in SCOP 1.65
- d1o1ra_ appears in SCOP 1.67
- d1o1ra_ appears in the current release, SCOPe 2.08
View in 3D
