Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (8 PDB entries) psychrophilic alkaline protease |
Domain d1o0ta2: 1o0t A:3-244 [86545] Other proteins in same PDB: d1o0ta1 complexed with ca, so4 |
PDB Entry: 1o0t (more details), 2.5 Å
SCOPe Domain Sequences for d1o0ta2:
Sequence, based on SEQRES records: (download)
>d1o0ta2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl yg
>d1o0ta2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd nptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg
Timeline for d1o0ta2: