Lineage for d1o0sa2 (1o0s A:2-295)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174487Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1174488Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 1174628Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 1174639Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 1174700Species Pig roundworm (Ascaris suum) [TaxId:6253] [75254] (2 PDB entries)
  8. 1174701Domain d1o0sa2: 1o0s A:2-295 [86541]
    Other proteins in same PDB: d1o0sa1, d1o0sb1
    complexed with nai, ttn

Details for d1o0sa2

PDB Entry: 1o0s (more details), 2 Å

PDB Description: crystal structure of ascaris suum malic enzyme complexed with nadh
PDB Compounds: (A:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d1o0sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]}
svahhedvyshnlppmdekemalyklyrpervtpkkrsaellkeprlnkgmgfslyerqy
lglhgllppafmtqeqqayrvitklreqpndlaryiqldglqdrneklfyrvvcdhvkel
mpivytptvglacqnfgyiyrkpkglyitindnsvskiyqilsnwheedvraivvtdger
ilglgdlgaygigipvgklalyvalggvqpkwclpvlldvgtnnmdllndpfyiglrhkr
vrgkdydtlldnfmkactkkygqktliqfedfanpnafrlldkyqdkytmfndd

SCOPe Domain Coordinates for d1o0sa2:

Click to download the PDB-style file with coordinates for d1o0sa2.
(The format of our PDB-style files is described here.)

Timeline for d1o0sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o0sa1