![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
![]() | Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins) Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand |
![]() | Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species) |
![]() | Species Pig roundworm (Ascaris suum) [TaxId:6253] [75254] (2 PDB entries) |
![]() | Domain d1o0sa2: 1o0s A:2-295 [86541] Other proteins in same PDB: d1o0sa1, d1o0sb1 complexed with nai, ttn |
PDB Entry: 1o0s (more details), 2 Å
SCOPe Domain Sequences for d1o0sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} svahhedvyshnlppmdekemalyklyrpervtpkkrsaellkeprlnkgmgfslyerqy lglhgllppafmtqeqqayrvitklreqpndlaryiqldglqdrneklfyrvvcdhvkel mpivytptvglacqnfgyiyrkpkglyitindnsvskiyqilsnwheedvraivvtdger ilglgdlgaygigipvgklalyvalggvqpkwclpvlldvgtnnmdllndpfyiglrhkr vrgkdydtlldnfmkactkkygqktliqfedfanpnafrlldkyqdkytmfndd
Timeline for d1o0sa2: