SCOPe 2.08: Domain d1o0sa2: 1o0s A:2-295

Lineage for d1o0sa2 (1o0s A:2-295)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [75254] (2 PDB entries)

8. Domain d1o0sa2: 1o0s A:2-295 [86541]
   Other proteins in same PDB: d1o0sa1, d1o0sb1
   complexed with nai, ttn

Details for d1o0sa2

PDB Entry: 1o0s, 2 Å

PDB Description: crystal structure of ascaris suum malic enzyme complexed with nadh

PDB Compounds: (A:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d1o0sa2:

Sequence; same for both SEQRES and ATOM records:

>d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]}
svahhedvyshnlppmdekemalyklyrpervtpkkrsaellkeprlnkgmgfslyerqy
lglhgllppafmtqeqqayrvitklreqpndlaryiqldglqdrneklfyrvvcdhvkel
mpivytptvglacqnfgyiyrkpkglyitindnsvskiyqilsnwheedvraivvtdger
ilglgdlgaygigipvgklalyvalggvqpkwclpvlldvgtnnmdllndpfyiglrhkr
vrgkdydtlldnfmkactkkygqktliqfedfanpnafrlldkyqdkytmfndd

Timeline for d1o0sa2:

• d1o0sa2 first appeared in SCOP 1.65
  
• d1o0sa2 appears in SCOPe 2.07