Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species) includes C-terminal additional subdomains |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [75117] (2 PDB entries) |
Domain d1o0sa1: 1o0s A:296-603 [86540] Other proteins in same PDB: d1o0sa2, d1o0sb2 complexed with nai, ttn has additional subdomain(s) that are not in the common domain |
PDB Entry: 1o0s (more details), 2 Å
SCOPe Domain Sequences for d1o0sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} iqgtasvivaglltctrvtkklvsqekylffgagaastgiaemivhqmqnegiskeeacn riylmdidglvtknrkemnprhvqfakdmpettsileviraarpgaligastvrgafnee viramaeinerpiifalsnptskaectaeeaytftngaalyasgspfpnfelnghtykpg qgnnayifpgvalgtilfqirhvdndlfllaakkvascvtedslkvgrvypqlkeireis iqiavemakycykngtanlypqpedlekyvraqvynteyeelinatydwpeqdmrhgfpv pvvrhdsm
Timeline for d1o0sa1: