SCOPe 2.08: Domain d1o0sa1: 1o0s A:296-603

Lineage for d1o0sa1 (1o0s A:296-603)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
   includes C-terminal additional subdomains

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [75117] (2 PDB entries)

8. Domain d1o0sa1: 1o0s A:296-603 [86540]
   Other proteins in same PDB: d1o0sa2, d1o0sb2
   complexed with nai, ttn
   has additional subdomain(s) that are not in the common domain

Details for d1o0sa1

PDB Entry: 1o0s, 2 Å

PDB Description: crystal structure of ascaris suum malic enzyme complexed with nadh

PDB Compounds: (A:) NAD-dependent malic enzyme

SCOPe Domain Sequences for d1o0sa1:

Sequence; same for both SEQRES and ATOM records:

>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]}
iqgtasvivaglltctrvtkklvsqekylffgagaastgiaemivhqmqnegiskeeacn
riylmdidglvtknrkemnprhvqfakdmpettsileviraarpgaligastvrgafnee
viramaeinerpiifalsnptskaectaeeaytftngaalyasgspfpnfelnghtykpg
qgnnayifpgvalgtilfqirhvdndlfllaakkvascvtedslkvgrvypqlkeireis
iqiavemakycykngtanlypqpedlekyvraqvynteyeelinatydwpeqdmrhgfpv
pvvrhdsm

Timeline for d1o0sa1:

• d1o0sa1 first appeared in SCOP 1.65
  
• d1o0sa1 appears in SCOPe 2.07