Lineage for d1o0la_ (1o0l A:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236526Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1236566Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1236567Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1236568Protein Apoptosis regulator Bcl-w [90103] (1 species)
  7. 1236569Species Human (Homo sapiens) [TaxId:9606] [90104] (3 PDB entries)
  8. 1236571Domain d1o0la_: 1o0l A: [86534]

Details for d1o0la_

PDB Entry: 1o0l (more details)

PDB Description: the structure of bcl-w reveals a role for the c-terminal residues in modulating biological activity
PDB Compounds: (A:) Apoptosis regulator Bcl-W

SCOPe Domain Sequences for d1o0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0la_ f.1.4.1 (A:) Apoptosis regulator Bcl-w {Human (Homo sapiens) [TaxId: 9606]}
gplgsmatpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefet
rfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkem
eplvgqvqewmveyletrladwihssggwaeftalygdgaleearrlregnwasvrtvlt
gavalgal

SCOPe Domain Coordinates for d1o0la_:

Click to download the PDB-style file with coordinates for d1o0la_.
(The format of our PDB-style files is described here.)

Timeline for d1o0la_: