Lineage for d1o0la1 (1o0l A:1-183)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021131Protein Apoptosis regulator Bcl-w [90103] (1 species)
  7. 3021132Species Human (Homo sapiens) [TaxId:9606] [90104] (3 PDB entries)
  8. 3021134Domain d1o0la1: 1o0l A:1-183 [86534]
    Other proteins in same PDB: d1o0la2

Details for d1o0la1

PDB Entry: 1o0l (more details)

PDB Description: the structure of bcl-w reveals a role for the c-terminal residues in modulating biological activity
PDB Compounds: (A:) Apoptosis regulator Bcl-W

SCOPe Domain Sequences for d1o0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0la1 f.1.4.1 (A:1-183) Apoptosis regulator Bcl-w {Human (Homo sapiens) [TaxId: 9606]}
matpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrt
fsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvg
qvqewmveyletrladwihssggwaeftalygdgaleearrlregnwasvrtvltgaval
gal

SCOPe Domain Coordinates for d1o0la1:

Click to download the PDB-style file with coordinates for d1o0la1.
(The format of our PDB-style files is described here.)

Timeline for d1o0la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o0la2