Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins) |
Protein Hypothetical protein HI1161 [89905] (1 species) |
Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries) |
Domain d1o0ib_: 1o0i B: [86533] structural genomics; NESG target IR63 complexed with mse |
PDB Entry: 1o0i (more details), 1.7 Å
SCOP Domain Sequences for d1o0ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0ib_ d.38.1.5 (B:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte enklccvsrltlsvinl
Timeline for d1o0ib_: