SCOP 1.71: Domain d1o0ca1: 1o0c A:339-547

Lineage for d1o0ca1 (1o0c A:339-547)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families)

5. Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)

6. Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species)
   duplication, consists of two barrel domains with the swapping of N-terminal strands

7. Species Escherichia coli [TaxId:562] [50721] (13 PDB entries)

8. Domain d1o0ca1: 1o0c A:339-547 [86529]
   Other proteins in same PDB: d1o0ca2
   complexed with amp, glu, so4; mutant

Details for d1o0ca1

PDB Entry: 1o0c, 2.7 Å

PDB Description: crystal structure of l-glutamate and ampcpp bound to glutamine aminoacyl trna synthetase

SCOP Domain Sequences for d1o0ca1:

Sequence, based on SEQRES records:

>d1o0ca1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records):

>d1o0ca1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

Timeline for d1o0ca1:

• d1o0ca1 first appeared in SCOP 1.65
  
• d1o0ca1 appears in SCOP 1.69
  
• d1o0ca1 appears in SCOP 1.73
  
• d1o0ca1 appears in the current release, SCOPe 2.08