Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (10 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.6: beta-Phosphoglucomutase [75173] (1 protein) |
Protein beta-Phosphoglucomutase [75174] (1 species) |
Species Lactococcus lactis [TaxId:1358] [75175] (3 PDB entries) |
Domain d1o03a_: 1o03 A: [86507] complexed with g16, mg; mutant |
PDB Entry: 1o03 (more details), 1.4 Å
SCOP Domain Sequences for d1o03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o03a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis} mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
Timeline for d1o03a_: