SCOP 1.65: Domain d1o03a_: 1o03 A:

Lineage for d1o03a_ (1o03 A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (10 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase [75173] (1 protein)

6. Protein beta-Phosphoglucomutase [75174] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [75175] (3 PDB entries)

8. Domain d1o03a_: 1o03 A: [86507]
   complexed with g16, mg; mutant

Details for d1o03a_

PDB Entry: 1o03, 1.4 Å

PDB Description: structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate

SCOP Domain Sequences for d1o03a_:

Sequence; same for both SEQRES and ATOM records:

>d1o03a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

Timeline for d1o03a_:

• d1o03a_ is new in SCOP 1.65
  
• d1o03a_ appears in SCOP 1.67
  
• d1o03a_ appears in the current release, SCOPe 2.08