SCOP 1.69: Domain d1nzva_: 1nzv A:

Lineage for d1nzva_ (1nzv A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (30 proteins)
   Pfam 00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)

8. Domain d1nzva_: 1nzv A: [86457]

Details for d1nzva_

PDB Entry: 1nzv, 2.1 Å

PDB Description: Crystal Structure of Src SH2 domain bound to doubly phosphorylated peptide PQpYIpYVPA

SCOP Domain Sequences for d1nzva_:

Sequence, based on SEQRES records:

>d1nzva_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Sequence, based on observed residues (ATOM records):

>d1nzva_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresetgayclsvsdfdnakglnvkhykirk
ldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Timeline for d1nzva_:

• d1nzva_ first appeared in SCOP 1.65
  
• d1nzva_ appears in SCOP 1.67
  
• d1nzva_ appears in SCOP 1.71
  
• d1nzva_ appears in the current release, SCOPe 2.08