Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (25 proteins) |
Protein c-src tyrosine kinase [55556] (3 species) |
Species Rous sarcoma virus [TaxId:11886] [69782] (11 PDB entries) |
Domain d1nzlb_: 1nzl B: [86454] complexed with doubly phosphorylated peptide, chain C complexed with cl, pg4, ptr |
PDB Entry: 1nzl (more details), 1.9 Å
SCOP Domain Sequences for d1nzlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzlb_ d.93.1.1 (B:) c-src tyrosine kinase {Rous sarcoma virus} aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
Timeline for d1nzlb_: