SCOP 1.65: Domain d1nzlb_: 1nzl B:

Lineage for d1nzlb_ (1nzl B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (25 proteins)

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Rous sarcoma virus [TaxId:11886] [69782] (11 PDB entries)

8. Domain d1nzlb_: 1nzl B: [86454]
   complexed with doubly phosphorylated peptide, chain C
   complexed with cl, pg4, ptr

Details for d1nzlb_

PDB Entry: 1nzl, 1.9 Å

PDB Description: Crystal Structure of Src SH2 domain bound to doubly phosphorylated peptide PQpYEpYIPI

SCOP Domain Sequences for d1nzlb_:

Sequence; same for both SEQRES and ATOM records:

>d1nzlb_ d.93.1.1 (B:) c-src tyrosine kinase {Rous sarcoma virus}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Timeline for d1nzlb_:

• d1nzlb_ is new in SCOP 1.65
  
• d1nzlb_ appears in SCOP 1.67
  
• d1nzlb_ appears in the current release, SCOPe 2.08