Lineage for d1nzib1 (1nzi B:3-117)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041738Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041739Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2041740Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 protein domains)
  6. 2041744Protein Complement C1S component [89258] (1 species)
  7. 2041745Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries)
  8. 2041747Domain d1nzib1: 1nzi B:3-117 [86451]
    Other proteins in same PDB: d1nzia2, d1nzib2
    complexed with ca, mg

Details for d1nzib1

PDB Entry: 1nzi (more details), 1.5 Å

PDB Description: Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s
PDB Compounds: (B:) Complement C1s component

SCOPe Domain Sequences for d1nzib1:

Sequence, based on SEQRES records: (download)

>d1nzib1 b.23.1.1 (B:3-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
tmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgdt
eegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatdi

Sequence, based on observed residues (ATOM records): (download)

>d1nzib1 b.23.1.1 (B:3-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
tmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgdt
eegrlcgqrssnphspiveefqvpynklqvifksdfsneerftgfaayyvatdi

SCOPe Domain Coordinates for d1nzib1:

Click to download the PDB-style file with coordinates for d1nzib1.
(The format of our PDB-style files is described here.)

Timeline for d1nzib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nzib2