Lineage for d1nz4a_ (1nz4 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903200Species Horse (Equus caballus) [TaxId:9796] [46474] (53 PDB entries)
  8. 903240Domain d1nz4a_: 1nz4 A: [86439]
    complexed with cd, hem

Details for d1nz4a_

PDB Entry: 1nz4 (more details), 1.8 Å

PDB Description: the horse heart myoglobin variant k45e/k63e complexed with cadmium
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1nz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz4a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
lkehgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d1nz4a_:

Click to download the PDB-style file with coordinates for d1nz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1nz4a_: