Lineage for d1nz3a_ (1nz3 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276464Protein Myoglobin [46469] (9 species)
  7. 276469Species Horse (Equus caballus) [TaxId:9796] [46474] (18 PDB entries)
  8. 276475Domain d1nz3a_: 1nz3 A: [86438]
    complexed with hem; mutant

Details for d1nz3a_

PDB Entry: 1nz3 (more details), 1.6 Å

PDB Description: k45e-k63e variant of horse heart myoglobin

SCOP Domain Sequences for d1nz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz3a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
lkehgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1nz3a_:

Click to download the PDB-style file with coordinates for d1nz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1nz3a_: