SCOP 1.65: Domain d1nz2a_: 1nz2 A:

Lineage for d1nz2a_ (1nz2 A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (18 PDB entries)

8. Domain d1nz2a_: 1nz2 A: [86437]
   complexed with hem, sul; mutant

Details for d1nz2a_

PDB Entry: 1nz2, 1.9 Å

PDB Description: k45e variant of horse heart myoglobin

SCOP Domain Sequences for d1nz2a_:

Sequence; same for both SEQRES and ATOM records:

>d1nz2a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1nz2a_:

• d1nz2a_ is new in SCOP 1.65
  
• d1nz2a_ appears in SCOP 1.67
  
• d1nz2a_ appears in the current release, SCOPe 2.08