Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.2: RNase P protein [54220] (1 protein) |
Protein RNase P protein [54221] (3 species) |
Species Thermotoga maritima [TaxId:243274] [89821] (1 PDB entry) |
Domain d1nz0d_: 1nz0 D: [86436] complexed with mse, so4; mutant |
PDB Entry: 1nz0 (more details), 1.2 Å
SCOP Domain Sequences for d1nz0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nz0d_ d.14.1.2 (D:) RNase P protein {Thermotoga maritima} rrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrw vreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
Timeline for d1nz0d_: