Lineage for d1nz0d_ (1nz0 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598279Family d.14.1.2: RNase P protein [54220] (1 protein)
  6. 598280Protein RNase P protein [54221] (3 species)
  7. 598285Species Thermotoga maritima [TaxId:243274] [89821] (1 PDB entry)
  8. 598289Domain d1nz0d_: 1nz0 D: [86436]
    complexed with mse, so4; mutant

Details for d1nz0d_

PDB Entry: 1nz0 (more details), 1.2 Å

PDB Description: rnase p protein from thermotoga maritima

SCOP Domain Sequences for d1nz0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz0d_ d.14.1.2 (D:) RNase P protein {Thermotoga maritima}
rrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrw
vreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg

SCOP Domain Coordinates for d1nz0d_:

Click to download the PDB-style file with coordinates for d1nz0d_.
(The format of our PDB-style files is described here.)

Timeline for d1nz0d_: