SCOPe 2.07: Domain d1nz0c_: 1nz0 C:

Lineage for d1nz0c_ (1nz0 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.2: RNase P protein [54220] (2 proteins)
   automatically mapped to Pfam PF00825

6. Protein RNase P protein [54221] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [89821] (1 PDB entry)

8. Domain d1nz0c_: 1nz0 C: [86435]
   complexed with so4

Details for d1nz0c_

PDB Entry: 1nz0, 1.2 Å

PDB Description: rnase p protein from thermotoga maritima

PDB Compounds: (C:) Ribonuclease P protein component

SCOPe Domain Sequences for d1nz0c_:

Sequence; same for both SEQRES and ATOM records:

>d1nz0c_ d.14.1.2 (C:) RNase P protein {Thermotoga maritima [TaxId: 2336]}
lrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvrei
frrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg

Timeline for d1nz0c_:

• d1nz0c_ first appeared in SCOP 1.65
  
• d1nz0c_ appears in SCOPe 2.06
  
• d1nz0c_ appears in the current release, SCOPe 2.08