Lineage for d1nz0c_ (1nz0 C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853160Family d.14.1.2: RNase P protein [54220] (1 protein)
  6. 853161Protein RNase P protein [54221] (3 species)
  7. 853166Species Thermotoga maritima [TaxId:2336] [89821] (1 PDB entry)
  8. 853169Domain d1nz0c_: 1nz0 C: [86435]

Details for d1nz0c_

PDB Entry: 1nz0 (more details), 1.2 Å

PDB Description: rnase p protein from thermotoga maritima
PDB Compounds: (C:) Ribonuclease P protein component

SCOP Domain Sequences for d1nz0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz0c_ d.14.1.2 (C:) RNase P protein {Thermotoga maritima [TaxId: 2336]}
lrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvrei
frrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg

SCOP Domain Coordinates for d1nz0c_:

Click to download the PDB-style file with coordinates for d1nz0c_.
(The format of our PDB-style files is described here.)

Timeline for d1nz0c_: