![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.2: RNase P protein [54220] (2 proteins) automatically mapped to Pfam PF00825 |
![]() | Protein RNase P protein [54221] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89821] (1 PDB entry) |
![]() | Domain d1nz0a_: 1nz0 A: [86433] complexed with so4 |
PDB Entry: 1nz0 (more details), 1.2 Å
SCOPe Domain Sequences for d1nz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nz0a_ d.14.1.2 (A:) RNase P protein {Thermotoga maritima [TaxId: 2336]} erlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvr eifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
Timeline for d1nz0a_: