Lineage for d1nz0a_ (1nz0 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499246Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 499247Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 499298Family d.14.1.2: RNase P protein [54220] (1 protein)
  6. 499299Protein RNase P protein [54221] (3 species)
  7. 499304Species Thermotoga maritima [TaxId:243274] [89821] (1 PDB entry)
  8. 499305Domain d1nz0a_: 1nz0 A: [86433]

Details for d1nz0a_

PDB Entry: 1nz0 (more details), 1.2 Å

PDB Description: rnase p protein from thermotoga maritima

SCOP Domain Sequences for d1nz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz0a_ d.14.1.2 (A:) RNase P protein {Thermotoga maritima}
erlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvr
eifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg

SCOP Domain Coordinates for d1nz0a_:

Click to download the PDB-style file with coordinates for d1nz0a_.
(The format of our PDB-style files is described here.)

Timeline for d1nz0a_: