Lineage for d1nz0a_ (1nz0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930242Family d.14.1.2: RNase P protein [54220] (2 proteins)
    automatically mapped to Pfam PF00825
  6. 2930243Protein RNase P protein [54221] (3 species)
  7. 2930248Species Thermotoga maritima [TaxId:2336] [89821] (1 PDB entry)
  8. 2930249Domain d1nz0a_: 1nz0 A: [86433]
    complexed with so4

Details for d1nz0a_

PDB Entry: 1nz0 (more details), 1.2 Å

PDB Description: rnase p protein from thermotoga maritima
PDB Compounds: (A:) Ribonuclease P protein component

SCOPe Domain Sequences for d1nz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz0a_ d.14.1.2 (A:) RNase P protein {Thermotoga maritima [TaxId: 2336]}
erlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvr
eifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg

SCOPe Domain Coordinates for d1nz0a_:

Click to download the PDB-style file with coordinates for d1nz0a_.
(The format of our PDB-style files is described here.)

Timeline for d1nz0a_: