Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein Activin A (Inhibin beta A) [90170] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90171] (10 PDB entries) Uniprot P08476 311-426 |
Domain d1nyud_: 1nyu D: [86428] Other proteins in same PDB: d1nyua_, d1nyuc_ complexed with the extracellular domain of activin type II receptor fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1nyu (more details), 3.1 Å
SCOPe Domain Sequences for d1nyud_:
Sequence, based on SEQRES records: (download)
>d1nyud_ g.17.1.2 (D:) Activin A (Inhibin beta A) {Human (Homo sapiens) [TaxId: 9606]} cckkqffvsfkdigwndwiiapsgyhanycegecpshiagtsgsslsfhstvinhyrmrg hspfanlksccvptklrpmsmlyyddgqniikkdiqnmiveecgcs
>d1nyud_ g.17.1.2 (D:) Activin A (Inhibin beta A) {Human (Homo sapiens) [TaxId: 9606]} cckkffvsiiapsgyhnycegecpccvptklrpmsmlyyddgiikkdiqnmiveecgcs
Timeline for d1nyud_: