Lineage for d1nyuc_ (1nyu C:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 342525Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulphide-rich fold: nearly all-beta
  4. 342526Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 342677Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 342695Protein Type II activin receptor [57357] (2 species)
  7. 342700Species Rat (Rattus norvegicus) [TaxId:10116] [90154] (2 PDB entries)
  8. 342704Domain d1nyuc_: 1nyu C: [86427]
    Other proteins in same PDB: d1nyub_, d1nyud_
    complexed with activin A

Details for d1nyuc_

PDB Entry: 1nyu (more details), 3.1 Å

PDB Description: crystal structure of activin a bound to the ecd of actriib

SCOP Domain Sequences for d1nyuc_:

Sequence, based on SEQRES records: (download)

>d1nyuc_ g.7.1.3 (C:) Type II activin receptor {Rat (Rattus norvegicus)}
treciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncy
drqecvateenpqvyfcccegnfcnerfthlpe

Sequence, based on observed residues (ATOM records): (download)

>d1nyuc_ g.7.1.3 (C:) Type II activin receptor {Rat (Rattus norvegicus)}
treciyynanwlertnqsglercegeqdkrlhcyaswtielvkkgcwldfncyecvatee
npqvyfcccegnfcnerfthlpe

SCOP Domain Coordinates for d1nyuc_:

Click to download the PDB-style file with coordinates for d1nyuc_.
(The format of our PDB-style files is described here.)

Timeline for d1nyuc_: