Lineage for d1nyua_ (1nyu A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063168Protein Type II activin receptor [57357] (3 species)
  7. 1063177Species Norway rat (Rattus norvegicus) [TaxId:10116] [90154] (2 PDB entries)
  8. 1063180Domain d1nyua_: 1nyu A: [86425]
    Other proteins in same PDB: d1nyub_, d1nyud_
    complexed with activin A

Details for d1nyua_

PDB Entry: 1nyu (more details), 3.1 Å

PDB Description: crystal structure of activin a bound to the ecd of actriib
PDB Compounds: (A:) activin receptor

SCOPe Domain Sequences for d1nyua_:

Sequence, based on SEQRES records: (download)

>d1nyua_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
treciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncy
drqecvateenpqvyfcccegnfcnerfthlpe

Sequence, based on observed residues (ATOM records): (download)

>d1nyua_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
treciyynanwelertnqslercegeqdkrlhcyaswrnssgtielvkkgcwlddfncyd
rqecvateenpqvyfcccegnfcnerfthlpe

SCOPe Domain Coordinates for d1nyua_:

Click to download the PDB-style file with coordinates for d1nyua_.
(The format of our PDB-style files is described here.)

Timeline for d1nyua_: