Lineage for d1nyua_ (1nyu A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522220Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 522221Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 522382Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 522403Protein Type II activin receptor [57357] (3 species)
  7. 522411Species Rat (Rattus norvegicus) [TaxId:10116] [90154] (2 PDB entries)
  8. 522414Domain d1nyua_: 1nyu A: [86425]
    Other proteins in same PDB: d1nyub_, d1nyud_

Details for d1nyua_

PDB Entry: 1nyu (more details), 3.1 Å

PDB Description: crystal structure of activin a bound to the ecd of actriib

SCOP Domain Sequences for d1nyua_:

Sequence, based on SEQRES records: (download)

>d1nyua_ g.7.1.3 (A:) Type II activin receptor {Rat (Rattus norvegicus)}
treciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncy
drqecvateenpqvyfcccegnfcnerfthlpe

Sequence, based on observed residues (ATOM records): (download)

>d1nyua_ g.7.1.3 (A:) Type II activin receptor {Rat (Rattus norvegicus)}
treciyynanwelertnqslercegeqdkrlhcyaswrnssgtielvkkgcwlddfncyd
rqecvateenpqvyfcccegnfcnerfthlpe

SCOP Domain Coordinates for d1nyua_:

Click to download the PDB-style file with coordinates for d1nyua_.
(The format of our PDB-style files is described here.)

Timeline for d1nyua_: