Lineage for d1nytd1 (1nyt D:102-270)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309102Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 309304Protein Shikimate 5-dehydrogenase AroE [89538] (2 species)
  7. 309308Species Escherichia coli [TaxId:562] [89539] (1 PDB entry)
  8. 309312Domain d1nytd1: 1nyt D:102-270 [86423]
    Other proteins in same PDB: d1nyta2, d1nytb2, d1nytc2, d1nytd2
    complexed with dtt, nap, so4

Details for d1nytd1

PDB Entry: 1nyt (more details), 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+

SCOP Domain Sequences for d1nytd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nytd1 c.2.1.7 (D:102-270) Shikimate 5-dehydrogenase AroE {Escherichia coli}
dgvgllsdlerlsfirpglrilligaggasrgvllpllsldcavtitnrtvsraeelakl
fahtgsiqalsmdeleghefdliinatssgisgdipaipsslihpgiycydmfyqkgktp
flawceqrgskrnadglgmlvaqaahafllwhgvlpdvepvikqlqeel

SCOP Domain Coordinates for d1nytd1:

Click to download the PDB-style file with coordinates for d1nytd1.
(The format of our PDB-style files is described here.)

Timeline for d1nytd1: