![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
![]() | Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins) |
![]() | Protein Shikimate 5-dehydrogenase AroE [89584] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [89585] (1 PDB entry) |
![]() | Domain d1nytc2: 1nyt C:1-101 [86422] Other proteins in same PDB: d1nyta1, d1nytb1, d1nytc1, d1nytd1 complexed with dtv, nap, so4 |
PDB Entry: 1nyt (more details), 1.5 Å
SCOPe Domain Sequences for d1nytc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nytc2 c.58.1.5 (C:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv tvpfkeeafaradelteraalagavntlmrledgrllgdnt
Timeline for d1nytc2: