Lineage for d1nytc2 (1nyt C:1-101)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703519Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 703520Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 703746Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 703755Protein Shikimate 5-dehydrogenase AroE [89584] (3 species)
  7. 703759Species Escherichia coli [TaxId:562] [89585] (1 PDB entry)
  8. 703762Domain d1nytc2: 1nyt C:1-101 [86422]
    Other proteins in same PDB: d1nyta1, d1nytb1, d1nytc1, d1nytd1

Details for d1nytc2

PDB Entry: 1nyt (more details), 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+
PDB Compounds: (C:) Shikimate 5-dehydrogenase

SCOP Domain Sequences for d1nytc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nytc2 c.58.1.5 (C:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}
metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
tvpfkeeafaradelteraalagavntlmrledgrllgdnt

SCOP Domain Coordinates for d1nytc2:

Click to download the PDB-style file with coordinates for d1nytc2.
(The format of our PDB-style files is described here.)

Timeline for d1nytc2: