SCOP 1.71: Domain d1nytb1: 1nyt B:102-271

Lineage for d1nytb1 (1nyt B:102-271)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Shikimate 5-dehydrogenase AroE [89538] (3 species)

7. Species Escherichia coli [TaxId:562] [89539] (1 PDB entry)

8. Domain d1nytb1: 1nyt B:102-271 [86419]
   Other proteins in same PDB: d1nyta2, d1nytb2, d1nytc2, d1nytd2

Details for d1nytb1

PDB Entry: 1nyt, 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+

SCOP Domain Sequences for d1nytb1:

Sequence; same for both SEQRES and ATOM records:

>d1nytb1 c.2.1.7 (B:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli}
dgvgllsdlerlsfirpglrilligaggasrgvllpllsldcavtitnrtvsraeelakl
fahtgsiqalsmdeleghefdliinatssgisgdipaipsslihpgiycydmfyqkgktp
flawceqrgskrnadglgmlvaqaahafllwhgvlpdvepvikqlqeels

Timeline for d1nytb1:

• d1nytb1 first appeared in SCOP 1.65
  
• d1nytb1 appears in SCOP 1.69
  
• d1nytb1 appears in SCOP 1.73
  
• d1nytb1 appears in the current release, SCOPe 2.08