| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein Shikimate 5-dehydrogenase AroE [89538] (2 species) |
| Species Escherichia coli [TaxId:562] [89539] (1 PDB entry) |
| Domain d1nytb1: 1nyt B:102-271 [86419] Other proteins in same PDB: d1nyta2, d1nytb2, d1nytc2, d1nytd2 |
PDB Entry: 1nyt (more details), 1.5 Å
SCOP Domain Sequences for d1nytb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nytb1 c.2.1.7 (B:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli}
dgvgllsdlerlsfirpglrilligaggasrgvllpllsldcavtitnrtvsraeelakl
fahtgsiqalsmdeleghefdliinatssgisgdipaipsslihpgiycydmfyqkgktp
flawceqrgskrnadglgmlvaqaahafllwhgvlpdvepvikqlqeels
Timeline for d1nytb1: